DPPA5 anticorps (N-Term)

N° du produit ABIN630614

L’anticorps Lapin Polyclonal anti-DPPA5 a été validé pour WB. Il convient pour détecter DPPA5 dans des échantillons de Humain.

Aperçu rapide pour DPPA5 anticorps (N-Term) (ABIN630614)

Antigène: DPPA5 (Developmental Pluripotency Associated 5 (DPPA5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPPA5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DPPA5 anticorps

Épitope: N-Term

Specificité: DPPA5 antibody was raised against the N terminal of DPPA5

Purification: Affinity purified

Immunogène: DPPA5 antibody was raised using the N terminal of DPPA5 corresponding to a region with amino acids MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPPA5 Blocking Peptide, (ABIN5613253), is also available for use as a blocking control in assays to test for specificity of this DPPA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPPA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPPA5

Antigène: DPPA5 (Developmental Pluripotency Associated 5 (DPPA5))

Autre désignation: DPPA5

Sujet: DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.

Poids moléculaire: 13 kDa (MW of target protein)